General Information

  • ID:  hor006900
  • Uniprot ID:  P05230
  • Protein name:  Fibroblast growth factor 1
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  Heparin-binding growth factors family
  • Source:  Animal
  • Expression:  Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005938 cell cortex; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0031012 extracellular matrix; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005654 nucleoplasm; GO:0005634 nucleus
  • GO BP:  GO:0008083 growth factor activity; GO:0030544 Hsp70 protein binding; GO:0005178 integrin binding; GO:0005104 fibroblast growth factor receptor binding; GO:0008201 heparin binding; GO:0044548 S100 protein binding
  • GO CC:  GO:0045542 positive regulation of cholesterol biosynthetic process; GO:0007165 signal transduction; GO:1901509 regulation of endothelial tube morphogenesis; GO:0010595 positive regulation of endothelial cell migration; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0010628 positive regulation of gene expression; GO:2000347 positive regulation of hepatocyte proliferation; GO:1902533 positive regulation of intracellular signal transduction; GO:0043406 positive regulation of MAP kinase activity; GO:1903672 positive regulation of sprouting angiogenesis; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0008284 positive regulation of cell population proliferation; GO:2000544 regulation of endothelial cell chemotaxis to fibroblast growth factor; GO:0030334 regulation of cell migration; GO:0051781 positive regulation of cell division; GO:0045766 positive regulation of angiogenesis; GO:0001759 organ induction; GO:0072163 mesonephric epithelium development; G

Sequence Information

  • Sequence:  NLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
  • Length:  139
  • Propeptide:  MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
  • Signal peptide:  NA
  • Modification:  T105 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA